RAD9B anticorps

N° du produit ABIN634195

Cet anticorps Lapin Polyclonal détecte spécifiquement RAD9B dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour RAD9B anticorps (ABIN634195)

Antigène: RAD9B (RAD9 Homolog B (RAD9B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAD9B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAD9B anticorps

Purification: Affinity purified

Immunogène: RAD9 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAD9B Blocking Peptide, (ABIN5615738), is also available for use as a blocking control in assays to test for specificity of this RAD9B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAD9B

Antigène: RAD9B (RAD9 Homolog B (RAD9B))

Autre désignation: RAD9B

Sujet: The function of RAD9B protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 28 kDa (MW of target protein)